Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169163
Description
IL-5 Polyclonal specifically detects IL-5 in Mouse samples. It is validated for Western Blot.Specifications
| IL-5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| IL5 | |
| Synthetic peptides corresponding to Il5 (interleukin 5) The peptide sequence was selected from the middle region of Il5. Peptide sequence MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL. | |
| Affinity purified | |
| RUO | |
| 3567 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| B-cell differentiation factor I, EDF, Eosinophil differentiation factor, IL-5T-cell replacing factor, interleukin 5 (colony-stimulating factor, eosinophil), interleukin-5, TRFB cell differentiation factor I | |
| Rabbit | |
| 15 kDa | |
| 100 μL | |
| Primary | |
| Pig: 86%. | |
| Human, Mouse, Rat, Guinea Pig, Rabbit | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction