Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL17RE Mouse anti-Human, Clone: 46N7E3, Invitrogen™

Mouse Monoclonal Antibody

Manufacturer:  Invitrogen MA524806

Catalog No. PIMA524806


Add to cart

Description

Description

Immunogen amino acids (97-199) contain the sequence MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE.

The interleukin 17 receptor E (IL-17RE) shares limited similarity to the receptor of IL-17A, a ubiquitous type I membrane glycoprotein that with IL-17A plays a pathogenic role in many inflammatory and autoimmune diseases such as rheumatoid arthritis. IL-17RE is the functional receptor of IL-17C and has been suggested to mediate mucosal immunity to infection with intestinal pathogens. IL-17C is produced by epithelia in response to bacterial challenge and binds to a receptor complex formed by IL-17RE and IL-17RA on the epithelial cell surface, thereby regulating the immune function of epithelial cells in an autocrine manner.
Specifications

Specifications

IL17RE
Monoclonal
0.5 mg/mL
PBS with 0.05% BSA and 0.05% sodium azide; pH 7.4
Q8NFR9
IL-17 receptor E, interleukin 17 receptor E
Mouse
IgG2b, kappa
100 μg
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Primary
132014
Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
46N7E3
Unconjugated
IL17RE
Liquid
IL17RE
Recombit human IL17E which corresponds to Amino acids (97-199).
Protein G
RUO
Antibody
Monoclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit