Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL18R1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen IL18R1
Immunogen Synthetic peptides corresponding to IL18R1(interleukin 18 receptor 1) The peptide sequence was selected from the N terminal of IL18R1. Peptide sequence PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15972020 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15972020UL
20ul Each for $149.00
Add to cart
 
NBP159720 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159720
100 ul Each for $329.00
Add to cart
 
Description

Description

IL18R1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

IL18R1
Rabbit
Polyclonal
Unconjugated
8809
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to IL18R1(interleukin 18 receptor 1) The peptide sequence was selected from the N terminal of IL18R1. Peptide sequence PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE.
Primary
IgG
CD218 antigen-like family member A, CD218a, CD218a antigen, CDw218a, cytokine receptor, IL-18R1, IL-18R-1, IL1R-rp, IL1RRPIL1 receptor-related protein, IL-1RrpIL18RA, interleukin 18 receptor 1, interleukin-18 receptor 1
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit