Abnova™ IL1B (Human) Recombinant Protein (Q01)

Human IL1B partial ORF with GST-tag at N-terminal

Supplier:  Abnova™ H00003553Q0110

Catalog No. 89-020-371

Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.

• Theoretical MW: 36.63kDa
• Preparation Method: In vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Best use within three months from the date of receipt of this protein

Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array

Specifications

• Accession Number: AAH08678
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Molecular Weight (g/mol): 36.63
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 10 ug
• Immunogen: DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Gene Alias: IL-1/IL1-BETA/IL1F2
• Gene Symbol: IL1B
• Species: Wheat Germ (in vitro)
• Protein Tag: GST

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 3553
• Name: IL1B (Human) Recombinant Protein (Q01)
• Preparation Method: In vitro wheat germ expression system
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Source: Wheat Germ (in vitro)
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: IL1B
• Cross Reactivity: Human
• Recombinant: Recombinant
• Form: Solution