Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IMMP2L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179838
Description
IMMP2L Polyclonal specifically detects IMMP2L in Human samples. It is validated for Western Blot.Specifications
IMMP2L | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 3.4.21, EC 3.4.21.-, IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae), IMP2 inner mitochondrial membrane protease-like (S. cerevisiae), IMP2inner mitochondrial membrane peptidase 2 like, IMP2-LIKE, IMP2-like protein, mitochondrial inner membrane protease subunit 2 | |
Rabbit | |
20 kDa | |
100 μL | |
Signal Transduction | |
83943 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_115938 | |
IMMP2L | |
Synthetic peptide directed towards the N terminal of human IMMP2LThe immunogen for this antibody is IMMP2L. Peptide sequence LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE. | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Chicken: 92%; Zebrafish: 92%. | |
Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction