IMMP2L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179838

Catalog No. NBP179838

Description

IMMP2L Polyclonal specifically detects IMMP2L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IMMP2L
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_115938
• Gene Symbols: IMMP2L
• Immunogen: Synthetic peptide directed towards the N terminal of human IMMP2LThe immunogen for this antibody is IMMP2L. Peptide sequence LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Chicken: 92%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.21, EC 3.4.21.-, IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae), IMP2 inner mitochondrial membrane protease-like (S. cerevisiae), IMP2inner mitochondrial membrane peptidase 2 like, IMP2-LIKE, IMP2-like protein, mitochondrial inner membrane protease subunit 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 83943
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.