Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Importin 11 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | Importin 11 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB123597
|
Novus Biologicals
NBP309348100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
Importin 11 Polyclonal specifically detects Importin 11 in Rat samples. It is validated for Western Blot.Specifications
| Importin 11 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| imp11, importin 11, Ran binding protein 11, Ran-binding protein 11, RANBP11, RanBP11importin-11, SLRN | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Importin 11 (XP_226752). Peptide sequence VKNYAYKPSKNFEDSSPETLEAHKIKMAFFTYPTLTEICRRLVSHYFLLT | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 51194 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title