Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Importin alpha 5/KPNA1/SRP1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154604

 View more versions of this product

Catalog No. NBP154604



Description

Description

Importin alpha 5/KPNA1/SRP1 Polyclonal specifically detects Importin alpha 5/KPNA1/SRP1 in Human, Mouse samples. It is validated for Western Blot.
Specifications

Specifications

Importin alpha 5/KPNA1/SRP1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
importin subunit alpha-1, importin-alpha-S1, IPOA5, karyopherin alpha 1 (importin alpha 5), Karyopherin subunit alpha-1, NPI-1SRP1importin alpha 5, Nucleoprotein interactor 1, RCH2RAG cohort protein 2, recombination activating gene cohort 2, SRP1-beta
Rabbit
60 kDa
100 μL
Primary
This product is specific to Subunit or Isoform: alpha-1.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
IgG
Western Blot, Immunohistochemistry
0.5 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry
P52294
KPNA1
Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS.
Affinity purified
RUO
3836
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit