Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Importin alpha 5/KPNA1/SRP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Importin alpha 5/KPNA1/SRP1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15460420
|
Novus Biologicals
NBP15460420UL |
20 μL |
Each for $152.22
|
|
NBP154604
|
Novus Biologicals
NBP154604 |
100 μL |
Each for $436.00
|
|
Description
Importin alpha 5/KPNA1/SRP1 Polyclonal specifically detects Importin alpha 5/KPNA1/SRP1 in Human samples. It is validated for Western Blot.Specifications
| Importin alpha 5/KPNA1/SRP1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| importin subunit alpha-1, importin-alpha-S1, IPOA5, karyopherin alpha 1 (importin alpha 5), Karyopherin subunit alpha-1, NPI-1SRP1importin alpha 5, Nucleoprotein interactor 1, RCH2RAG cohort protein 2, recombination activating gene cohort 2, SRP1-beta | |
| KPNA1 | |
| IgG | |
| Affinity Purified | |
| This product is specific to Subunit or Isoform: alpha-1. |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| RUO | |
| P52294 | |
| 3836 | |
| Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. | |
| 60 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title