Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Importin alpha 5/KPNA1/SRP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$204.00 - $482.50


Antigen Importin alpha 5/KPNA1/SRP1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
20 μL
Each for $204.00
Add to Cart
View Documents
Novus Biologicals
100 μL
Each for $482.50
Add to Cart


Importin alpha 5/KPNA1/SRP1 Polyclonal specifically detects Importin alpha 5/KPNA1/SRP1 in Human, Mouse samples. It is validated for Western Blot.


Importin alpha 5/KPNA1/SRP1
Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS.
60 kDa
Western Blot, Immunohistochemistry
importin subunit alpha-1, importin-alpha-S1, IPOA5, karyopherin alpha 1 (importin alpha 5), Karyopherin subunit alpha-1, NPI-1SRP1importin alpha 5, Nucleoprotein interactor 1, RCH2RAG cohort protein 2, recombination activating gene cohort 2, SRP1-beta
This product is specific to Subunit or Isoform: alpha-1.


Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit