Importin alpha 5/KPNA1/SRP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154603

Catalog No. NBP154603

Description

Importin alpha 5/KPNA1/SRP1 Polyclonal specifically detects Importin alpha 5/KPNA1/SRP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Importin alpha 5/KPNA1/SRP1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Accession No.: P52294
• Gene Symbols: KPNA1
• Immunogen: Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3836
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: importin subunit alpha-1, importin-alpha-S1, IPOA5, karyopherin alpha 1 (importin alpha 5), Karyopherin subunit alpha-1, NPI-1SRP1importin alpha 5, Nucleoprotein interactor 1, RCH2RAG cohort protein 2, recombination activating gene cohort 2, SRP1-beta
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha-1.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG