Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Inositol Monophosphatase 3/IMPAD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Inositol Monophosphatase 3/IMPAD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159472
|
Novus Biologicals
NBP159472 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Inositol Monophosphatase 3/IMPAD1 Polyclonal specifically detects Inositol Monophosphatase 3/IMPAD1 in Human samples. It is validated for Western Blot.Specifications
| Inositol Monophosphatase 3/IMPAD1 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| Q9NX62 | |
| 54928 | |
| Synthetic peptides corresponding to IMPAD1(inositol monophosphatase domain containing 1) The peptide sequence was selected from the middle region of IMPAD1. Peptide sequence TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 3.1.3, EC 3.1.3.25, FLJ20421, IMP 3, IMPA3IMPase 3, inositol monophosphatase 3, inositol monophosphatase domain containing 1, Inositol monophosphatase domain-containing protein 1, Inositol-1(or 4)-monophosphatase 3, Myo-inositol monophosphatase A3 | |
| IMPAD1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title