Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

INPP5B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154719

 View more versions of this product

Catalog No. NBP154719


Add to cart

Description

Description

INPP5B Polyclonal antibody specifically detects INPP5B in Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

INPP5B
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
INPP5B
Synthetic peptides corresponding to INPP5B(inositol polyphosphate-5-phosphatase, 75kDa) The peptide sequence was selected from the middle region of INPP5B. Peptide sequence IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN.
77 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
P32019
75kD, EC 3.1.3, inositol polyphosphate-5-phosphatase, 75kDa, MGC65156, MGC71303,5PTase, Phosphoinositide 5-phosphatase
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
3633
Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit