Integrin alpha 7 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174207

Catalog No. NBP174207

Description

Integrin alpha 7 Polyclonal specifically detects Integrin alpha 7 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Integrin alpha 7
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q63258
• Gene Symbols: ITGA7
• Immunogen: Synthetic peptides corresponding to the N terminal of Itga7. Immunizing peptide sequence CQQGTAATFSPDSHYLIFGAPGTYNWKGLLFVTNIDSSDPDQLVYKTLDP.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3679
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ25220, integrin alpha 7 chain, integrin alpha-7, integrin, alpha 7
• Host Species: Rabbit
• Molecular Weight of Antigen: 130 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG