Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Integrin alpha 7 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Integrin alpha 7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP174207
|
Novus Biologicals
NBP174207 |
100 μL |
Each of 1 for $436.00
|
|
Description
Integrin alpha 7 Polyclonal specifically detects Integrin alpha 7 in Rat samples. It is validated for Western Blot.Specifications
Integrin alpha 7 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ25220, integrin alpha 7 chain, integrin alpha-7, integrin, alpha 7 | |
ITGA7 | |
IgG | |
Affinity Purified | |
130 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q63258 | |
3679 | |
Synthetic peptides corresponding to the N terminal of Itga7. Immunizing peptide sequence CQQGTAATFSPDSHYLIFGAPGTYNWKGLLFVTNIDSSDPDQLVYKTLDP. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title