Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Integrin alpha 8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP15994020UL
Description
Integrin alpha 8 Polyclonal specifically detects Integrin alpha 8 in Human samples. It is validated for Western Blot.Specifications
Integrin alpha 8 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P53708 | |
ITGA8 | |
Synthetic peptides corresponding to ITGA8(integrin, alpha 8) The peptide sequence was selected from the N terminal of ITGA8. Peptide sequence GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
integrin alpha-8, integrin, alpha 8 | |
Rabbit | |
Affinity Purified | |
RUO | |
8516 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction