Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Intelectin-1/Omentin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen Intelectin-1/Omentin
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180494
View Documents
Novus Biologicals
NBP180494
100 μL
Each of 1 for $436.00
N/A
Description

Description

Intelectin-1/Omentin Polyclonal specifically detects Intelectin-1/Omentin in Human samples. It is validated for Western Blot.
Specifications

Specifications

Intelectin-1/Omentin
Polyclonal
Rabbit
NP_060095
55600
Synthetic peptide directed towards the middle region of human ITLN1. Peptide sequence WTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
Endothelial lectin HL-1, FLJ20022, Galactofuranose-binding lectin, hIntL, HL-1, intelectin 1 (galactofuranose binding), intelectin-1, INTLHL1, ITLNITLN-1, LFRIntestinal lactoferrin receptor, omentin
ITLN1
IgG
Affinity Purified
35 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit