Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Intelectin-1/Omentin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | Intelectin-1/Omentin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180494
|
Novus Biologicals
NBP180494 |
100 μL |
Each of 1 for $436.00
|
N/A | |||||
Description
Intelectin-1/Omentin Polyclonal specifically detects Intelectin-1/Omentin in Human samples. It is validated for Western Blot.Specifications
| Intelectin-1/Omentin | |
| Polyclonal | |
| Rabbit | |
| NP_060095 | |
| 55600 | |
| Synthetic peptide directed towards the middle region of human ITLN1. Peptide sequence WTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Endothelial lectin HL-1, FLJ20022, Galactofuranose-binding lectin, hIntL, HL-1, intelectin 1 (galactofuranose binding), intelectin-1, INTLHL1, ITLNITLN-1, LFRIntestinal lactoferrin receptor, omentin | |
| ITLN1 | |
| IgG | |
| Affinity Purified | |
| 35 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title