Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Intra Acrosomal Protein Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Intra Acrosomal Protein |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179534
|
Novus Biologicals
NBP179534 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Intra Acrosomal Protein Polyclonal specifically detects Intra Acrosomal Protein in Human samples. It is validated for Western Blot.Specifications
| Intra Acrosomal Protein | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| acrosomal protein SP-10, acrosomal vesicle protein 1D11S4365, SP-10, SPACA2, sperm protein 10 | |
| ACRV1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001603 | |
| 56 | |
| Synthetic peptide directed towards the N terminal of human ACRV1. Peptide sequence MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title