Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IRP2 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310538100UL
Description
IRP2 Polyclonal specifically detects IRP2 in Human, Mouse samples. It is validated for Western Blot.Specifications
IRP2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ACO3, EC 4.2.1.3, FLJ23381, IRE-BP 2, Iron regulatory protein 2, iron-responsive element binding protein 2, iron-responsive element-binding protein 2, IRP2IRP2AD | |
The immunogen is a synthetic peptide directed towards the middle region of human IRP2 (NP_004127). Peptide sequence IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK | |
100 μg | |
HIF Target Genes, Hypoxia, Lipid and Metabolism | |
3658 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction