ISYNA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154984

Catalog No. NBP154984

Description

ISYNA1 Polyclonal specifically detects ISYNA1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ISYNA1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 5.5.1.4, hINO1, hIPS, INO1, INOS, inositol-3-phosphate synthase 1, IPSIPS 1, MI-1-P synthase, MIP synthase, Myo-inositol 1-phosphate synthase A1, Myo-inositol-1-phosphate synthase
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 51477
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NPH2
• Gene Symbols: ISYNA1
• Immunogen: Synthetic peptides corresponding to ISYNA1(myo-inositol 1-phosphate synthase A1) The peptide sequence was selected from the N terminal of ISYNA1. Peptide sequence LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Rat: 86%; Equine: 86%; Mouse: 86%; Bovine: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Yeast
• Isotype: IgG