Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ITIH5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309494100UL
Description
ITIH5 Polyclonal specifically detects ITIH5 in Human samples. It is validated for Western Blot.Specifications
ITIH5 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
inter-alpha (globulin) inhibitor H5, inter-alpha-inhibitor heavy chain 5, inter-alpha-trypsin inhibitor heavy chain H5, ITI heavy chain H5, ITIH5 inter-alpha-trypsin inhibitor heavy chain family, member 5, ITI-HC5, PP14776 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ITIH5 (NP_001001851). Peptide sequence ASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKR | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
80760 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction