Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ITPR2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen ITPR2
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125612
View Documents
Novus Biologicals
NBP31035525UL
25 μg N/A
NB125611
View Documents
Novus Biologicals
NBP310355100UL
100 μg N/A
Description

Description

ITPR2 Polyclonal antibody specifically detects ITPR2 in Human samples. It is validated for Western Blot
Specifications

Specifications

ITPR2
Western Blot
Purified
RUO
Human
inositol 14,5-triphosphate receptor, type 2, inositol 14,5-trisphosphate receptor type 2, insP3R2, IP3 receptor, IP3 receptor isoform 2, IP3R 2, IP3R2, Type 2 inositol 14,5-trisphosphate receptor, Type 2 InsP3 receptor
The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN ITPR2. Peptide sequence FRDCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQ
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Neuroscience
PBS buffer, 2% sucrose
3709
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit