Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Jagged 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15828420UL
Description
Jagged 2 Polyclonal specifically detects Jagged 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Jagged 2 | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry | |
Q9Y219 | |
JAG2 | |
Synthetic peptides corresponding to JAG2(jagged 2) The peptide sequence was selected from the N terminal of JAG2. Peptide sequence RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD. | |
20 μL | |
Cell Cycle and Replication, Stem Cell Signaling Pathway | |
3714 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HJ2, jagged 2, Jagged2, protein jagged-2, SER2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title