Jagged 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158284

Catalog No. NBP158284

Description

Jagged 2 Polyclonal specifically detects Jagged 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Jagged 2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9Y219
• Gene Symbols: JAG2
• Immunogen: Synthetic peptides corresponding to JAG2(jagged 2) The peptide sequence was selected from the N terminal of JAG2. Peptide sequence RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Stem Cell Signaling Pathway
• Gene ID (Entrez): 3714
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HJ2, jagged 2, Jagged2, protein jagged-2, SER2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Porcine
• Isotype: IgG