Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JAKMIP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP247414
Description
JAKMIP2 Polyclonal specifically detects JAKMIP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
JAKMIP2 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
CTCL tumor antigen HD-CL-04, JAMIP2KIAA0555Jak and microtubule interacting protein 2, janus kinase and microtubule interacting protein 2, janus kinase and microtubule-interacting protein 2, NECC1, neuroendocrine long coiled-coil 1, Neuroendocrine long coiled-coil protein 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
9832 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
JAKMIP2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: KLQVIEQQNIIDELTRDREKLIRRRKHRRSSKPIKRPVLDPFIGYDEDSMDSETSSMASFRTDRT | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction