Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

JAZF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen JAZF1
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125961
View Documents
Novus Biologicals
NBP310530100UL
100 μg
Each for $320.71
N/A
NB125962
View Documents
Novus Biologicals
NBP31053025UL
25 μg
Each for $106.19
N/A
Description

Description

JAZF1 Polyclonal antibody specifically detects JAZF1 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

JAZF1
Western Blot, Immunohistochemistry
Purified
RUO
PBS buffer, 2% sucrose
221895
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Human
JAZF zinc finger 1, juxtaposed with another zinc finger gene 1, juxtaposed with another zinc finger protein 1, TAK1-interacting protein 27, TIP27ZNF802DKFZp761K2222, Zinc finger protein 802
The immunogen is a synthetic peptide directed towards the C terminal region of human JAZF1 (NP_778231). Peptide sequence KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFH
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit