Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JIP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | JIP2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB125057
|
Novus Biologicals
NBP310078100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
JIP2 Polyclonal specifically detects JIP2 in Human samples. It is validated for Western Blot.Specifications
JIP2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Apoptosis | |
PBS buffer, 2% sucrose | |
23542 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
C-Jun-amino-terminal kinase-interacting protein 2, homologous to mouse JIP-1, IB-2, IB2JIP2Mitogen-activated protein kinase 8-interacting protein 2, islet-brain 2, Islet-brain-2, JIP-2, JNK MAP kinase scaffold protein 2, JNK MAP kinase scaffold protein JIP2, JNK-interacting protein 2, mitogen-activated protein kinase 8 interacting protein 2, PRKM8 interacting protein-like, PRKM8IPL | |
The immunogen is a synthetic peptide directed towards the middle region of human JIP2 (NP_036456.1). Peptide sequence SEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNL | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title