Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JMJD6/PSR Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | JMJD6/PSR |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126725
|
Novus Biologicals
NBP310913100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
JMJD6/PSR Polyclonal specifically detects JMJD6/PSR in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| JMJD6/PSR | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Epigenetics, Stem Cell Signaling Pathway | |
| PBS buffer, 2% sucrose | |
| 23210 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| bifunctional arginine demethylase and lysyl-hydroxylase JMJD6, EC 1.14.11, EC 1.14.11.-, Histone arginine demethylase JMJD6, JmjC domain-containing protein 6, jumonji domain containing 6, Jumonji domain-containing protein 6, KIAA0585PSR, Lysyl-hydroxylase JMJD6, Peptide-lysine 5-dioxygenase JMJD6, Phosphatidylserine receptorPTDSR, Protein PTDSR, PTDSR1 | |
| The immunogen is a synthetic peptide directed towards the middle region of human JMJD6/PSR (NP_055982). Peptide sequence PRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGE | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title