Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JMJD8 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17971520UL
Description
JMJD8 Polyclonal specifically detects JMJD8 in Mouse samples. It is validated for Western Blot.Specifications
JMJD8 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_082377 | |
JMJD8 | |
The immunogen for this antibody is Jmjd8. Peptide sequence PAYSFGIAGAGSGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTT. | |
Affinity Purified | |
RUO | |
339123 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
jmjC domain-containing protein 8, C16orf20, jumonji domain containing 8, PP14397 | |
Rabbit | |
30 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title