Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JMJD8 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | JMJD8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17971520
|
Novus Biologicals
NBP17971520UL |
20 μL |
Each for $152.22
|
|
NBP179715
|
Novus Biologicals
NBP179715 |
100 μL |
Each for $436.00
|
|
Description
JMJD8 Polyclonal specifically detects JMJD8 in Mouse samples. It is validated for Western Blot.Specifications
| JMJD8 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| jmjC domain-containing protein 8, C16orf20, jumonji domain containing 8, PP14397 | |
| JMJD8 | |
| IgG | |
| Affinity Purified | |
| 30 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_082377 | |
| 339123 | |
| The immunogen for this antibody is Jmjd8. Peptide sequence PAYSFGIAGAGSGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title