Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
JOSD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15670920UL
Description
JOSD2 Polyclonal specifically detects JOSD2 in Human samples. It is validated for Western Blot.Specifications
JOSD2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8TAC2 | |
JOSD2 | |
Synthetic peptides corresponding to JOSD2(Josephin domain containing 2) The peptide sequence was selected from the N terminal of JOSD2. Peptide sequence QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 3.4.19.12, FLJ29018, Josephin domain containing 2, Josephin domain-containing protein 2, Josephin-2, SBBI54 | |
Rabbit | |
Affinity Purified | |
RUO | |
126119 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title