Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

JWA Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP30999625UL

 View more versions of this product

Catalog No. NB124894


Add to cart

Description

Description

JWA Polyclonal antibody specifically detects JWA in Mouse samples. It is validated for Western Blot
Specifications

Specifications

JWA
Unconjugated
PBS buffer, 2% sucrose
ADP-ribosylation factor-like protein 6-interacting protein 5, ADP-ribosylation-like factor 6 interacting protein 5, Aip-5, ARL-6-interacting protein 5, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla-derived protein 11, DERP11addicsin, Glutamate transporter EAAC1-interacting protein, glutamate transporter EEAC1-associated protein, GTRAP3-18aip-5, hp22, HSPC127, JM5, jmx, JWAcytoskeleton related vitamin A responsive protein, PRA1 domain family 3, PRA1 family protein 3, PRA2, PRAF3dermal papilla derived protein 11, Prenylated Rab acceptor protein 2, Protein JWa, putative MAPK activating protein PM27, Putative MAPK-activating protein PM27
The immunogen is a synthetic peptide directed towards the N terminal region of human JWA (NP_075368.1). Peptide sequence MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVV
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
10550
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit