Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KA2/GRIK5/Glutamate Receptor KA2 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180270

 View more versions of this product

Catalog No. NBP180270

Add to cart



KA2/GRIK5/Glutamate Receptor KA2 Polyclonal antibody specifically detects KA2/GRIK5/Glutamate Receptor KA2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence.


KA2/GRIK5/Glutamate Receptor KA2
PBS, 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the middle region of human GRIK5. Peptide sequence EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM.
Immunogen affinity purified
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:2000
EAA2, Excitatory amino acid receptor 2, glutamate receptor KA2, Glutamate receptor KA-2, glutamate receptor, ionotropic kainate 5, glutamate receptor, ionotropic, kainate 5, KA2GRIK2
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit