Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KA2/GRIK5/Glutamate Receptor KA2 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18027020UL

 View more versions of this product

Catalog No. NBP18027020

Add to cart



KA2/GRIK5/Glutamate Receptor KA2 Polyclonal antibody specifically detects Antigen in Human, Mouse samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blotting.


KA2/GRIK5/Glutamate Receptor KA2
PBS & 2% Sucrose. with No Preservative
Affinity Purified
Synthetic peptide directed towards the middle region of human GRIK5. Peptide sequence EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM.
Immunogen affinity purified
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:2000
EAA2, Excitatory amino acid receptor 2, glutamate receptor KA2, Glutamate receptor KA-2, glutamate receptor, ionotropic kainate 5, glutamate receptor, ionotropic, kainate 5, KA2GRIK2
Store at -20C. Avoid freeze-thaw cycles.
Human, Mouse
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit