Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KALRN Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310025100UL
Description
KALRN Polyclonal specifically detects KALRN in Human samples. It is validated for Western Blot.Specifications
| KALRN | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| ARHGEF24, DUETFLJ16443, DUO, EC 2.7.11.1, FLJ12332, FLJ18623, HAPIP, huntingtin-associated protein interacting protein (duo), Huntingtin-associated protein-interacting protein, Kalirin, kalirin, RhoGEF kinase, Protein Duo, serine/threonine kinase with Dbl- and pleckstrin homology domains, Serine/threonine-protein kinase with Dbl- and pleckstrin homology domain, TRADFLJ18196 | |
| The immunogen is a synthetic peptide directed towards the middle region of human KALRN (NP_001019831.2). Peptide sequence QGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSLLAARQ | |
| 100 μg | |
| Neuroscience | |
| 8997 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction