Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KAT4/TBP Associated Factor 1 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen KAT4/TBP Associated Factor 1
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation, Immunohistochemistry
Applications Western Blot, ChIP assay, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126780
View Documents
Novus Biologicals
NBP31094025UL
25 μg
Each for $106.19
Add to cart
 
NB126779
View Documents
Novus Biologicals
NBP310940100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

KAT4/TBP Associated Factor 1 Polyclonal antibody specifically detects KAT4/TBP Associated Factor 1 in Human, Mouse samples. It is validated for Western Blot, ChIP assay, Immunohistochemistry
Specifications

Specifications

KAT4/TBP Associated Factor 1
Western Blot, ChIP assay, Immunohistochemistry
Purified
RUO
Human, Mouse
250kDa, BA2Rdystonia 3 (with Parkinsonism), CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD, CCGS, Cell cycle gene 1 protein, cell cycle, G1 phase defect, complementation of cell cycle block, G1-to-S, DYT3/TAF1, EC 2.7.11, EC 2.7.11.1, KAT4, NSCL2, OF, P250, TAF(II)250, TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2AN-TAF1, TAFII-250, TAFII250DYT3, TBP-associated factor 250 kDa, transcription factor TFIID p250 polypeptide, Transcription initiation factor TFIID 250 kDa subunit, transcription initiation factor TFIID subunit 1, XDP
The immunogen is a synthetic peptide directed towards the C terminal region of human KAT4/TBP Associated Factor 1 (NP_620278). Peptide sequence YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation, Immunohistochemistry
Unconjugated
Rabbit
Protein Kinase
PBS buffer, 2% sucrose
6872
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit