Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KAT4/TBP Associated Factor 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | KAT4/TBP Associated Factor 1 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126777
|
Novus Biologicals
NBP310939100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
KAT4/TBP Associated Factor 1 Polyclonal specifically detects KAT4/TBP Associated Factor 1 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.Specifications
KAT4/TBP Associated Factor 1 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
250kDa, BA2Rdystonia 3 (with Parkinsonism), CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD, CCGS, Cell cycle gene 1 protein, cell cycle, G1 phase defect, complementation of cell cycle block, G1-to-S, DYT3/TAF1, EC 2.7.11, EC 2.7.11.1, KAT4, NSCL2, OF, P250, TAF(II)250, TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2AN-TAF1, TAFII-250, TAFII250DYT3, TBP-associated factor 250 kDa, transcription factor TFIID p250 polypeptide, Transcription initiation factor TFIID 250 kDa subunit, transcription initiation factor TFIID subunit 1, XDP | |
The immunogen is a synthetic peptide directed towards the middle region of human KAT4/TBP Associated Factor 1 (NP_004597). Peptide sequence MMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEE | |
Affinity purified |
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation | |
Unconjugated | |
Rabbit | |
Protein Kinase | |
PBS buffer, 2% sucrose | |
6872 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title