Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
katanin-p80 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310015100UL
Description
katanin-p80 Polyclonal specifically detects katanin-p80 in Human samples. It is validated for Western Blot.Specifications
katanin-p80 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
KAT, katanin (80 kDa), katanin p80 (WD repeat containing) subunit B 1, katanin p80 (WD40-containing) subunit B 1, Katanin p80 subunit B1, katanin p80 WD40-containing subunit B1, p80 katanin | |
The immunogen is a synthetic peptide directed towards the middle region of human katanin-p80 (NP_005877.2). Peptide sequence RVKQNSESERRSPSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPR | |
100 μg | |
Stem Cell Markers | |
10300 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction