Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KBTBD12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | KBTBD12 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124383
|
Novus Biologicals
NBP309741100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
KBTBD12 Polyclonal specifically detects KBTBD12 in Human samples. It is validated for Western Blot.Specifications
KBTBD12 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
kelch domain containing 6, kelch repeat and BTB (POZ) domain containing 12, kelch repeat and BTB domain-containing protein 12, KLHDC6 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KBTBD12 (NP_997218). Peptide sequence TAVVNSEIYVLGGIGCVGQDKGQVRKCLDVVEIYNPDGDFWREGPPMPSP | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
166348 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title