KCNK13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180083

Catalog No. NBP180083

Description

KCNK13 Polyclonal specifically detects KCNK13 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KCNK13
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_071337
• Gene Symbols: KCNK13
• Immunogen: Synthetic peptide directed towards the C terminal of human KCNK13. Peptide sequence SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%.
• Target Species: Human, Bovine, Canine, Equine
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: K2p13.1, potassium channel subfamily K member 13, potassium channel, subfamily K, member 13, tandem pore domain potassium channel THIK-1, THIK-1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56659
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG