Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCNK13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | KCNK13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180083
|
Novus Biologicals
NBP180083 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
KCNK13 Polyclonal specifically detects KCNK13 in Human samples. It is validated for Western Blot.Specifications
| KCNK13 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_071337 | |
| 56659 | |
| Synthetic peptide directed towards the C terminal of human KCNK13. Peptide sequence SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| K2p13.1, potassium channel subfamily K member 13, potassium channel, subfamily K, member 13, tandem pore domain potassium channel THIK-1, THIK-1 | |
| KCNK13 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title