Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KCNMB4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen KCNMB4
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125622
View Documents
Novus Biologicals
NBP31036025UL
25 μg
Each for $106.19
Add to cart
 
NB125621
View Documents
Novus Biologicals
NBP310360100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

KCNMB4 Polyclonal antibody specifically detects KCNMB4 in Human samples. It is validated for Western Blot
Specifications

Specifications

KCNMB4
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
27345
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
BK channel subunit beta-4, BKbeta4, calcium-activated potassium channel subunit beta-4, Calcium-activated potassium channel, subfamily M subunit beta-4, Charybdotoxin receptor subunit beta-4, hbeta4, K(VCA)beta-4, large conductance calcium-dependent potassium ion channel beta 4 subunit, Maxi K channel subunit beta-4, potassium large conductance calcium-activated channel, subfamily M, beta member4, slo-beta-4
The immunogen is a synthetic peptide directed towards the middle region of human KCNMB4 (NP_055320). Peptide sequence TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit