KCNRG Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180108

Catalog No. NBP180108

Description

KCNRG Polyclonal specifically detects KCNRG in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KCNRG
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_775876
• Gene Symbols: KCNRG
• Immunogen: Synthetic peptide directed towards the N terminal of human KCNRG. Peptide sequence VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Pig: 92%; Bovine: 85%; Rat: 84%.
• Target Species: Human, Rat, Porcine, Bovine, Canine, Equine, Rabbit
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CLLD4, potassium channel regulatorDLTET, Protein CLLD4, putative potassium channel regulatory protein
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 283518
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG