Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCNRG Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | KCNRG |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180108
|
Novus Biologicals
NBP180108 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
KCNRG Polyclonal specifically detects KCNRG in Human samples. It is validated for Western Blot.Specifications
| KCNRG | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_775876 | |
| 283518 | |
| Synthetic peptide directed towards the N terminal of human KCNRG. Peptide sequence VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CLLD4, potassium channel regulatorDLTET, Protein CLLD4, putative potassium channel regulatory protein | |
| KCNRG | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title