Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCTD18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258341
Description
KCTD18 Polyclonal specifically detects KCTD18 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| KCTD18 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| BTB/POZ domain-containing protein KCTD18, FLJ31322, FLJ37818, potassium channel tetramerisation domain containing 18,6530404F10Rik | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 130535 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| KCTD18 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGVYATKTDGTDAIEK | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction