Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP30998625UL

 View more versions of this product

Catalog No. NB124874


Add to cart

Description

Description

KF1 Polyclonal antibody specifically detects KF1 in Human samples. It is validated for Western Blot
Specifications

Specifications

KF1
Unconjugated
PBS buffer, 2% sucrose
E3 ubiquitin-protein ligase RNF103, EC 6.3.2.-, hkf-1, KF-1, KF1ZFP103ZFP-103, MGC102815, ring finger protein 103MGC41857, Zfp-103, Zinc finger protein 103 homolog, zinc finger protein 103 homolog (mouse), zinc finger protein expressed in cerebellum
The immunogen is a synthetic peptide directed towards the middle region of human KF1 (NP_001185880.1). Peptide sequence HPALFLSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSY
25 μg
Zinc Finger
Primary
7844
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit