KHDRBS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156317

Catalog No. NBP156317

Description

KHDRBS2 Polyclonal specifically detects KHDRBS2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KHDRBS2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5VWX1
• Gene Symbols: KHDRBS2
• Immunogen: Synthetic peptides corresponding to KHDRBS2(KH domain containing, RNA binding, signal transduction associated 2) The peptide sequence was selected from the middle region of KHDRBS2. Peptide sequence EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRG The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Zebrafish: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hSLM-1, KH domain containing, RNA binding, signal transduction associated 2, KH domain-containing, RNA-binding, signal transduction-associated protein 2, MGC26664, Sam68-like mammalian protein 1, SLM1bA535F17.1, SLM-1FLJ38664
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 202559
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.