Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KIAA0494 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $299.00

Specifications

Antigen KIAA0494
Immunogen Synthetic peptides corresponding to KIAA0494(KIAA0494) The peptide sequence was selected from the N terminal of KIAA0494. Peptide sequence DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15996720 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15996720UL
20ul Each for $149.00
Add to cart
 
NBP159967 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159967
100ul Each for $299.00
Add to cart
 
Description

Description

KIAA0494 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

KIAA0494
Rabbit
Polyclonal
Unconjugated
9813
Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
RUO
Synthetic peptides corresponding to KIAA0494(KIAA0494) The peptide sequence was selected from the N terminal of KIAA0494. Peptide sequence DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV.
Primary
IgG
hypothetical protein LOC9813, KIAA0494, RP11-8J9.3
PBS and 2% Sucrose with 0.09% Sodium Azide
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit