Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIAA1430 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | KIAA1430 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179676
|
Novus Biologicals
NBP179676 |
100 μL |
Each of 1 for $436.00
|
|
Description
CFAP97 Polyclonal specifically detects CFAP97 in Human samples. It is validated for Western Blot.Specifications
KIAA1430 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KIAA1430 | |
KIAA1430 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
NP_065878 | |
57587 | |
Synthetic peptide directed towards the middle region of human KIAA1430The immunogen for this antibody is KIAA1430. Peptide sequence NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title