Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIF1C Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | KIF1C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158137
|
Novus Biologicals
NBP158137 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
KIF1C Polyclonal specifically detects KIF1C in Human samples. It is validated for Western Blot.Specifications
| KIF1C | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| KIAA0706, kinesin family member 1C, kinesin-like protein KIF1C, LTXS1 | |
| KIF1C | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Immunology, Innate Immunity | |
| O43896 | |
| 10749 | |
| Synthetic peptides corresponding to KIF1C (kinesin family member 1C) The peptide sequence was selected from the C terminal of KIF1C. Peptide sequence GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title