Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KIF1C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen KIF1C
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158137
missing translation for 'viewDocuments'
Novus Biologicals
NBP158137
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

KIF1C Polyclonal specifically detects KIF1C in Human samples. It is validated for Western Blot.
Specifications

Specifications

KIF1C
Polyclonal
Purified
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
KIAA0706, kinesin family member 1C, kinesin-like protein KIF1C, LTXS1
KIF1C
IgG
Protein A purified
Western Blot
Unconjugated
Rabbit
Immunology, Innate Immunity
O43896
10749
Synthetic peptides corresponding to KIF1C (kinesin family member 1C) The peptide sequence was selected from the C terminal of KIF1C. Peptide sequence GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit