Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIF25 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | KIF25 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180036
|
Novus Biologicals
NBP180036 |
100 μL |
Each of 1 for $436.00
|
|
Description
KIF25 Polyclonal specifically detects KIF25 in Human samples. It is validated for Western Blot.Specifications
KIF25 | |
Polyclonal | |
Rabbit | |
Human | |
kinesin family member 25 | |
KIF25 | |
IgG | |
Affinity Purified | |
35 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_005346 | |
3834 | |
Synthetic peptide directed towards the N terminal of human KIF25. Peptide sequence: YNVCVMAYGQTGSGKSYTMLGRHSDDGPVLPLDPQSDLGIIPRVAEELFR | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title